Seqanswers Leaderboard Ad

Collapse

Announcement

Collapse
No announcement yet.
X
 
  • Filter
  • Time
  • Show
Clear All
new posts

  • Shishir
    replied
    Thanks Richard!

    Leave a comment:


  • Richard Finney
    replied
    cut -f1 -d" " inputold.fa > outputnew.fa

    Leave a comment:


  • Shishir
    started a topic Any script to format headers in fasta files?

    Any script to format headers in fasta files?

    I have a 47GB file to parse. The sequences are in following format:
    >TSCS_00041 gene0EA_12345_rframe2_ORF
    MLAATHYYKFAIRRLFPLLKDTICASYSISIKHHENFMALSNMPKIWEDVEVDGNNMQWTRFQTTPVMPVYFIAAGVFNLSFITNWNTKLLYRKDILPYMTFAYNVAKNIAWFLSHIRKTKITNHI
    >TSCS_00044 gene0EA_12341_rframe2_ORF
    MTICASYSISIKHHENFMAIKHHENFMALSNMPKIWEDV
    I simply want to format this file like:
    >TSCS_00041
    MLAATHYYKFAIRRLFPLLKDTICASYSISIKHHENFMALSNMPKIWEDVEVDGNNMQWTRFQTTPVMPVYFIAAGVFNLSFITNWNTKLLYRKDILPYMTFAYNVAKNIAWFLSHIRKTKITNHI
    >TSCS_00044
    MTICASYSISIKHHENFMAIKHHENFMALSNMPKIWEDV
    Could anyone share the script.

Latest Articles

Collapse

  • seqadmin
    Recent Advances in Sequencing Analysis Tools
    by seqadmin


    The sequencing world is rapidly changing due to declining costs, enhanced accuracies, and the advent of newer, cutting-edge instruments. Equally important to these developments are improvements in sequencing analysis, a process that converts vast amounts of raw data into a comprehensible and meaningful form. This complex task requires expertise and the right analysis tools. In this article, we highlight the progress and innovation in sequencing analysis by reviewing several of the...
    05-06-2024, 07:48 AM

ad_right_rmr

Collapse

News

Collapse

Topics Statistics Last Post
Started by seqadmin, Today, 10:28 AM
0 responses
5 views
0 likes
Last Post seqadmin  
Started by seqadmin, Today, 07:35 AM
0 responses
8 views
0 likes
Last Post seqadmin  
Started by seqadmin, Yesterday, 02:06 PM
0 responses
8 views
0 likes
Last Post seqadmin  
Started by seqadmin, 05-14-2024, 07:03 AM
0 responses
28 views
0 likes
Last Post seqadmin  
Working...
X