Announcement

Collapse
No announcement yet.

Create local BLAST database

Collapse
X
 
  • Filter
  • Time
  • Show
Clear All
new posts

  • Create local BLAST database

    Hi there,

    I tried to use makeblastdb to create a local BLAST database and got the following error message. I checked the FASTA format of my file and it seemed to be OK. No idea how to correct this problem. Any help would be greatly appreciated.

    "Error: NCBI C++ Exception:
    "..\..\..\..\..\src\serial\objistrasnb.cpp", line 164: Error: ncbi::CObjectI
    StreamAsnBinary::UnexpectedTagClassByte() - byte 0: unexpected tag class/constru
    cted: #255, should be #160 ( at Seq-entry)"

  • #2
    FAST sequence sample

    >gi|157676334|ref|NP_067082.2| transmembrane protein 8A precursor [Homo sapiens]
    MGRAGTGTGGEAVAAVVAGPLLLLLLARPPPASAGYSGKSEVGLVSEHFSQAPQRLSFYSWYGSARLFRF
    RVPPDAVLLRWLLQVSRESGAACTDAEITVHFRSGAPPVINPLGTSFPDDTAVQPSFQVGVPLSTTPRSN
    ASVNVSHPAPGDWFVAAHLPPSSQKIELKGLAPTCAYVFQPELLVTRVVEISIMEPDVPLPQTLLSHPSY
    LKVFVPDYTRELLLELRDCVSNGSLGCPVRLTVGPVTLPSNFQKVLTCTGAPWPCRLLLPSPPWDRWLQV
    TAESLVGPLGTVAFSAVAALTACRPRSVTIQPLLQSSQNQSFNASSGLLSPSPDHQDLGRSGRVDRSPFC
    LTNYPVTREDMDVVSVHFQPLDRVSVRVCSDTPSVMRLRLNTGMDSGGSLTISLRANKTEMRNETVVVAC
    VNAASPFLGFNTSLNCTTAFFQGYPLSLSAWSRRANLIIPYPETDNWYLSLQLMCPENAEDCEQAVVHVE
    TTLYLVPCLNDCGPYGQCLLLRRHSYLYASCSCKAGWRGWSCTDNSTAQTVAQQRAATLLLTLSNLMFLA
    PIAVSVRRFFLVEASVYAYTMFFSTFYHACDQPGEAVLCILSYDTLQYCDFLGSGAAIWVTILCMARLKT
    VLKYVLFLLGTLVIAMSLQLDRRGMWNMLGPCLFAFVIMASMWAYRCGHRRQCYPTSWQRWAFYLLPGVS
    MASVGIAIYTSMMTSDNYYYTHSIWHILLAGSAALLLPPPDQPAEPWACSQKFPCHYQICKNDREELYAV
    T

    Comment


    • #3
      What version of the NCBI executables are you using? What command line arguments are you using to create your database?

      Comment

      Working...
      X