My translated A.A seq longer than my original Nucleotide seq!! Could someone explain

[zaineb]

Hello everyone!

I am in the process of identifying an uncharacterized protein, when I convert my nucleotide sequence to Amino Acid using blastx, I get a long Amino Acid sequence. I am not sure if I am doing something wrong or missing a step or there is a biological explanation for it that I don't know of.

Nucleotide sequence / Accession Number X79334 region 333-548

GTTATTGTGTTCGCCGTTTTGCTGACGGCTTCTTGTCTGATGGTCTCCTTTGCCAACAGCTTTACGCTGC
TATTGCTGGACCGCGCCTGTCTTGGGTTGGCGCTGGACGGATTCTGGGCGATGTCGGCGTCGCTGACCAT
GCGACTGGTTCCCGCGCGTACCGTGCCGAAAGCGCTGTCGGTGATTTTTGGCGCGGTCTCCATCGCGTTA
GTGATC

Amino Acid Sequence / Protein accession number ERH37120.1


MNENIAEKFRADGVARPNWSAVFAVAFCVACLITVEFLPVSLLTPMAQDLGISEGIAGQSVTVTAFVAMF
SSLFITQIIQATDRRYIVILFAVLLTASCLMVSFANSFTLLLLGRACLGLALGGFWAMSASLTMRLVPAR
TVPKALSVIFGAVSIALVIAAPLGSFFGCXGISWSGRXALRPSAVMGVLC

I am new to Bioinformatics, but I am fascinated by this developing field. I was researching my question and came across this amazing website. I hope someone can help.

[mastal]

Did you check whether any part of the amino acid sequence corresponds to your nucleotide sequence?

Perhaps blastx translated the entire nucleotide sequence, 1-548, and not just the part annotated as a gene (333-548)? Would the length of the amino acid sequence be consistent with that?

[r.rosati]

This is the full sequence of a matching protein that you're seeing.
Your sequence translates to:
VIVFAVLLTASCLMVSFANSFTLLLLDRACLGLALDGFWAMSASLTMRLVPARTVPKALSVIFGAVSIALVI
And it was aligned to the segment starting "VILFAVLLTASCLMVSFANS".