Unconfigured Ad

Collapse
X
 
  • Filter
  • Time
  • Show
Clear All
new posts

  • cascoamarillo
    replied
    Thanks for the suggestion. Yep, the only way to get something from it was parsing it along. It's like a pre-clustal aligment with extra headers (it is from mid-late 90's).

    Leave a comment:


  • kwatts59
    replied
    I suggest writing a PERL script to convert the data into the format you desire.
    The alignment file looks very similar to Phylip format. Maybe you can just load it into Excel and manually modify it to the desired format.

    Leave a comment:


  • cascoamarillo
    started a topic What file format is this?

    What file format is this?

    Hi everyone,
    I found this alignment in a format I don't recognize, neither my phylogenetic programs. Any idea? And any way to convert it to fasta, phylip, etc...
    Thanks
    Code:
    193 Ce 13A10 Z46934        -------------------------MTQSLAHKNAWQC--   13
    194 Ce 13A8 Z48717 T10B9.4 ----------------------------------------    0
    195 Ce 13A7 Z48717 T10B9.10-------------------------MSFSI----------    5
    196 Ce 13A6 Z48717 T10B9.3 -------------------------MIFVL----------    5
    197 Ce 13A5 Z48717 T10B9.2 -------------------------MSLSI----------    5
    198 Ce 13A4 Z48717 T10B9.1 -------------------------MSLSL----------    5
    199 Ce 13A3 Z48717 T10B9.5 -------------------------MSLSI----------    5
    200 Ce 13A2 Z48717 T10B9.7 -------------------------MSLGF----------    5
    201 Ce 13A1 Z48717 T10B9.8 -------------------------MGYF-----------    4
    202 Ce 25A1 Z66495 C36A4.1 -------------------------MAL------------    0
    203 Ce 25A2 Z66495 C36A4.2 -------------------------MAL------------    0
    204 Ce 25A3 Z66495 C36A4.3 -------------------------MAF------------    0
    205 Ce 25A4 Z66495 C36A4.6 -------------------------MAI------------    0
    206 Ce 14A1 Z50742 K09A11.2----------------------------------------    0
    207 Ce 14A2 Z50742 K09A11.3----------------------------------------    0
    208 Ce 14A3 Z50742 K09A11.4----------------------------------------    0
    209 Ce 14A4 Z50742 + R04D3 ----------------------------------------    0
    210 Ce 16A1 Z54269         ----------------------------------------    0
        Ce      U55365 C12D5.7 ----------------------------------------    0
        Ce      U50311 C25E10.2----------------------------------------    0
    211 Ce 22A1 U39648 T13C5.1 SSWIKCRDWMAFALSHHIIMGIYLLILRNFLPQVVPDFEW    0
    212 Ce 23A1 U39472 B0304.3 -------------MPIAYFLPSQVNSGVCCLICRHWYLIG    0

Latest Articles

Collapse

  • mylaser
    Reply to Advanced Sequencing Platforms Tackle Neuroscience’s Toughest Genomics Problems
    by mylaser
    Kheloyar – Everything You Need to Know About Kheloyaar Login and Kheoyar Id
    If you are looking for an online gaming platform that offers a user-friendly experience, Kheloyar has become a name that many users search for. Whether you're interested in creating a new account, accessing your dashboard through Kheloyaar Login, or learning how to obtain a Kheoyar Id, understanding the platform's features and account process is essential.
    This guide explains everything you need to know about...
    Today, 01:13 AM
  • SEQadmin2
    Advanced Sequencing Platforms Tackle Neuroscience’s Toughest Genomics Problems
    by SEQadmin2



    Genomics studies in neuroscience face a special challenge due to the brain’s complexity and scarcity of samples. Mapping changes in cell type and state using conventional next-generation sequencing methods remains challenging. Advances in technologies like single-cell sequencing, spatial transcriptomics, and long-read sequencing have opened the door to deeper studies of the brain and diseases like Alzheimer’s, amyotrophic lateral sclerosis (ALS), and schizophrenia.
    ...
    07-09-2026, 11:10 AM
  • SEQadmin2
    Cancer Drug Resistance: The Lingering Barrier to Rising Survival
    by SEQadmin2



    Cancer survival rates have significantly increased in the last few decades in the United States, reaching a combined 70% 5-year survival rate by 2021. Behind this number, there are years of research to find new therapies, drug targets, and early detection methods. But there is one core challenge that keeps slowing down these advances, and it’s about drug resistance.

    There is no single reason why many patients don’t respond to treatment as expected. Cancer is...
    07-08-2026, 05:17 AM

ad_right_rmr

Collapse

News

Collapse

Topics Statistics Last Post
Started by SEQadmin2, 07-09-2026, 10:04 AM
0 responses
15 views
0 reactions
Last Post SEQadmin2  
Started by SEQadmin2, 07-08-2026, 10:08 AM
0 responses
10 views
0 reactions
Last Post SEQadmin2  
Started by SEQadmin2, 07-07-2026, 11:05 AM
0 responses
20 views
0 reactions
Last Post SEQadmin2  
Started by SEQadmin2, 07-02-2026, 11:08 AM
0 responses
31 views
0 reactions
Last Post SEQadmin2  
Working...