Unconfigured Ad

Collapse
X
 
  • Time
  • Show
Clear All
new posts
  • struggler
    Member
    • May 2012
    • 12

    #1

    nucleotide sequence extraction

    I wish to extract part of a sequence from a particular sequence/scaffold ID like 437 to 959 bases from a 3 Mb scaffold.

    I am more familiar with grep and used it before for like:
    grep -A 1 scaffoldID sequencefasta.fa > saveoutput.fa

    but don't know how to extract a particular part of the sequence.

    Could anyone help me with this please.

    S
  • maasha
    Senior Member
    • Apr 2009
    • 153

    #2
    Have a look at Galaxy.

    Alternatively you can use Biopieces like this:

    Code:
    read_fasta -i input.fasta |
    grab -p scaffoldID -k SEQ_NAME |
    extract_seq -b 437 -e 959 |
    write_fasta -o output.fasta -x

    Martin

    Comment

    • nexgengirl
      Member
      • Apr 2010
      • 31

      #3
      You could also use bedtools (code.google.com/p/bedtools/). I've used this tool to extract sub-sequence data before and I really like it because its fast and efficient.

      The tool in bedtools is called fastaFromBed (Creates FASTA sequences based on intervals in a BED/GFF/VCF file) and can extract sub-regions of a fasta by specifying those regions in a bed file.

      The manual is present here: http://code.google.com/p/bedtools/do...-Manual.v3.pdf

      Example of the command from the mannual

      fastaFromBed [OPTIONS] -fi <input FASTA> -bed <BED/GFF/VCF> -fo <output
      FASTA>

      Comment

      • struggler
        Member
        • May 2012
        • 12

        #4
        Thanks Maasha and NextGenGirl,
        I could not install these tools in my system. Scaffold name and sequence ID name are same. Could you please suggest solution from perl (like grep) only? I am using biolinux.
        Regards,
        S

        Comment

        • GenoMax
          Senior Member
          • Feb 2008
          • 7142

          #5
          I assume you are perhaps missing a compiler (gcc)/libraries when you say that you could not install these tools.

          Are you using a "live" image of biolinux to temporarily boot into a unix environment or are you using someone else's biolinux machine?


          Originally posted by struggler View Post
          I could not install these tools in my system. Scaffold name and sequence ID name are same. Could you please suggest solution from perl (like grep) only? I am using biolinux.
          Regards,
          S

          Comment

          • struggler
            Member
            • May 2012
            • 12

            #6
            Thanks for your message.

            This is on my own machine through VMWare. I guess I can install these using SUDO command. Instead of 'could not' it is more like I was afraid or sceptical to install these tools as if anything goes messy then I don't have much knowhow to correct it. So, I don't want to play with my standard installation.
            Regards,
            S

            Comment

            • GenoMax
              Senior Member
              • Feb 2008
              • 7142

              #7
              Give it a try. This is something you need to learn if you are planning to keep using *nix in some form.

              I doubt that you can cause major damage by installing bedtools ... but if you did manage to do that then perhaps you should not be using *nix in the first place

              I have not used VMWare lately. Are there any tools that allow you to make a backup of the image so just in case something does go wrong you can revert back to the old image.

              Originally posted by struggler View Post
              Thanks for your message.

              This is on my own machine through VMWare. I guess I can install these using SUDO command. Instead of 'could not' it is more like I was afraid or sceptical to install these tools as if anything goes messy then I don't have much knowhow to correct it. So, I don't want to play with my standard installation.
              Regards,
              S
              Last edited by GenoMax; 05-16-2012, 09:06 AM.

              Comment

              • struggler
                Member
                • May 2012
                • 12

                #8
                Although my username tells my status of knowledge but with your encouragement I shall give it a try sometime later.
                Regards,
                S

                Comment

                • nexgengirl
                  Member
                  • Apr 2010
                  • 31

                  #9
                  Hi struggler,

                  I agree with GenoMax. Try and install these tools. Otherwise, if you are concerned about that maasha's suggestion of Galaxy is also good. They have a tool there under Fetch sequences called "Extract Genomic DNA" and that is the tool I used to use before I learned how to use unix.

                  Comment

                  • twaddlac
                    Member
                    • Feb 2011
                    • 49

                    #10
                    EMBOSS (http://emboss.sourceforge.net/) is probably the most useful package for basic sequence manipulation/analysis.

                    Note that in order to utilize stdin/stdout you need to call the '-filter' flag and the '-auto' flag disables the parameter prompting. Their manual on the website is very informative.

                    I hope this helps!

                    Comment

                    • nexgenboy
                      Junior Member
                      • May 2012
                      • 1

                      #11
                      @struggler .. try this

                      #fasta file: pa101.fasta
                      >gi|129295|sp|P01013|OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED)
                      QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE
                      KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS
                      VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP
                      FLFLIKHNPTNTIVYFGRYWSP
                      #script: sequence_extractor.sh
                      #!/bin/bash

                      # The 1 based sequence extractor - sequence_extractor.sh
                      # No guarantees offered.

                      # usage:
                      # 1) download the script or copy the contents
                      # of the script and save it as sequence_extractor.sh
                      # 2) make it executable: chmod 755 sequence_extractor.sh
                      # reads from standard input or command line
                      # 3) run the script: ./sequence_extractor.sh ps101.fasta 4 6

                      # create a backup copy of the input fasta file
                      # and delete the header
                      sed -i.tmp -e '1d' $1 || exit $?

                      # merge the lines
                      temp_var1=`awk '{printf $0;}' $1` || exit $?

                      # select the region
                      temp_var2=$(((($3-1)-($2-1))+1)) || exit $?

                      # display the extracted sequence
                      echo ${temp_var1:$(($2-1)):$temp_var2} && mv $1.tmp $1 || exit $?

                      Comment

                      • Mark
                        Member
                        • Nov 2008
                        • 54

                        #12
                        From the ncbi toolkit, formatdb and fastacmd works nicely

                        first format your sequence file

                        formatdb -i <fasta sequence file> -p F -o T


                        This creates a blastable sequence db (a useful bonus). The "o" flag makes it searchable by fastacmd

                        then

                        fastacmd -d <fasta sequence file> -o <output file name> -p F -s <ID of record you want to retrieve> -L <start position,end_position>

                        Fastacmd can also retrieve many records at once. See the documentation.

                        Comment

                        • struggler
                          Member
                          • May 2012
                          • 12

                          #13
                          Dear Mark,
                          Many many thanks! The fastacmd command worked like a bullet!!

                          I am also thankful to all others for their helpful suggestions.

                          Regards,
                          S

                          Comment

                          Latest Articles

                          Collapse

                          • SEQadmin2
                            Proteomic Platforms: How to Choose the Right Analytical Strategy to Improve Detection and Clinical Applications
                            by SEQadmin2


                            Proteomics platforms are evolving rapidly, with advances in mass spectrometry and affinity-based approaches expanding what researchers can detect and at what scale. As the field moves toward deeper proteome coverage and clinical applications, scientists face an increasingly complex landscape of tools. This article will explore how researchers are navigating these choices to find the right platform for their work.

                            The systematic characterization of the human proteome has
                            ...
                            07-20-2026, 11:48 AM
                          • SEQadmin2
                            Advanced Sequencing Platforms Tackle Neuroscience’s Toughest Genomics Problems
                            by SEQadmin2



                            Genomics studies in neuroscience face a special challenge due to the brain’s complexity and scarcity of samples. Mapping changes in cell type and state using conventional next-generation sequencing methods remains challenging. Advances in technologies like single-cell sequencing, spatial transcriptomics, and long-read sequencing have opened the door to deeper studies of the brain and diseases like Alzheimer’s, amyotrophic lateral sclerosis (ALS), and schizophrenia.
                            ...
                            07-09-2026, 11:10 AM
                          • SEQadmin2
                            Cancer Drug Resistance: The Lingering Barrier to Rising Survival
                            by SEQadmin2



                            Cancer survival rates have significantly increased in the last few decades in the United States, reaching a combined 70% 5-year survival rate by 2021. Behind this number, there are years of research to find new therapies, drug targets, and early detection methods. But there is one core challenge that keeps slowing down these advances, and it’s about drug resistance.

                            There is no single reason why many patients don’t respond to treatment as expected. Cancer is...
                            07-08-2026, 05:17 AM

                          ad_right_rmr

                          Collapse

                          News

                          Collapse

                          Topics Statistics Last Post
                          Started by SEQadmin2, Today, 02:55 AM
                          0 responses
                          2 views
                          0 reactions
                          Last Post SEQadmin2  
                          Started by SEQadmin2, 07-24-2026, 12:17 PM
                          0 responses
                          10 views
                          0 reactions
                          Last Post SEQadmin2  
                          Started by SEQadmin2, 07-23-2026, 11:41 AM
                          0 responses
                          11 views
                          0 reactions
                          Last Post SEQadmin2  
                          Started by SEQadmin2, 07-20-2026, 11:10 AM
                          0 responses
                          23 views
                          0 reactions
                          Last Post SEQadmin2  
                          Working...