Unconfigured Ad

Collapse
X
Collapse
 
  • Page of 1
  • Time
  • Show
Clear All
new posts
Previous template Next
  • syintel87
    Member
    • Dec 2012
    • 81
    #1

    [blastp] Warning: CFastaReader: Ignoring invalid residue

    I put the command below. However, the warning messages has been shown. What does this mean and in what cases does this error occur?

    blastp -query trcds.fa -db nr -evalue 0.01 -out blast_to_nr_from_p.out -outfmt "6 qseqid sseqid pident length mismatch gapopen qstart qend sstart send evalue bitscore btop" &


    FA FILE

    >Medtr1g005000.1 gene=Medtr1g005000
    MLASPEDHPDARAQTGVHSLHIAGLRPLHAAPVFRRSRVAQLKLNLLFGNTRPGERDISRYCCLSYYFDT
    VVYVKVCTQERCSPPCMTSLSLH.
    >Medtr1g005010.1 gene=Medtr1g005010
    MSGYGQKSICNSFYRENKTHNLSLLGEEHGNLSLLAPESQKFDQLLPSSQAGKLARVVLALRLKAIGFPR
    ERDKEREA.
    >Medtr1g005020.1 gene=Medtr1g005020
    MHSELDCGSTIYRSEEISVVSHPILIISLEGRKTTTETGTKRPPTVTSTPGKAEALLGLRTRKTYFTLAF
    DLEPADLTDGLALPTSMPMDRGPGPTSKESATSGTAPLKKRKKKWKGVFHVKKINWAMFPEVGRLLSGQQ
    SSTSSRLLYDGLPCILGSARSSTLRPSK.


    WARNING MESSAGES

    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 3, position 23
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 6, position 8
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 10, position 28
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 16, position 69
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 23, position 12
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 29, position 54
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 35, position 66
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 38, position 40
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 42, position 42
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 51, position 66
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 55, position 32
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 57, position 55
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 59, position 58
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 64, position 30
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 67, position 5
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 73, position 44
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 76, position 3
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 80, position 0
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 83, position 39
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 85, position 57
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 88, position 6
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 90, position 63
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 94, position 61
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 97, position 26
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 111, position 20
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 115, position 57
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 118, position 58
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 121, position 56
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 126, position 5
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 142, position 5
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 147, position 35
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 150, position 6
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 153, position 6
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 159, position 49
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 162, position 14
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 168, position 55
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 172, position 48
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 175, position 5
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 180, position 23
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 184, position 0
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 186, position 69
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 191, position 23
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 194, position 2
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 198, position 39
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 203, position 40
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 208, position 43
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 212, position 26
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 215, position 30
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 218, position 20
    Warning: (1431.1) CFastaReader: Ignoring invalid residue . at line 225, position 41
    Tags: None
    • swbarnes2
      Senior Member
      • May 2008
      • 910
      #2
      It looks like it doesn't like the periods.

      use sed to get rid of them all.

        Comment

        Previous template Next

        Latest Articles

        Collapse
        • SEQadmin2
          Proteomic Platforms: How to Choose the Right Analytical Strategy to Improve Detection and Clinical Applications
          by SEQadmin2


          Proteomics platforms are evolving rapidly, with advances in mass spectrometry and affinity-based approaches expanding what researchers can detect and at what scale. As the field moves toward deeper proteome coverage and clinical applications, scientists face an increasingly complex landscape of tools. This article will explore how researchers are navigating these choices to find the right platform for their work.

          The systematic characterization of the human proteome has          ...
          07-20-2026, 11:48 AM
        • SEQadmin2
          Advanced Sequencing Platforms Tackle Neuroscience’s Toughest Genomics Problems
          by SEQadmin2



          Genomics studies in neuroscience face a special challenge due to the brain’s complexity and scarcity of samples. Mapping changes in cell type and state using conventional next-generation sequencing methods remains challenging. Advances in technologies like single-cell sequencing, spatial transcriptomics, and long-read sequencing have opened the door to deeper studies of the brain and diseases like Alzheimer’s, amyotrophic lateral sclerosis (ALS), and schizophrenia.
          ...
          07-09-2026, 11:10 AM
        • SEQadmin2
          Cancer Drug Resistance: The Lingering Barrier to Rising Survival
          by SEQadmin2



          Cancer survival rates have significantly increased in the last few decades in the United States, reaching a combined 70% 5-year survival rate by 2021. Behind this number, there are years of research to find new therapies, drug targets, and early detection methods. But there is one core challenge that keeps slowing down these advances, and it’s about drug resistance.

          There is no single reason why many patients don’t respond to treatment as expected. Cancer is...
          07-08-2026, 05:17 AM
        View All

        ad_right_rmr

        Collapse

        News

        Collapse
        Topics Statistics Last Post
        New Genomic Method Uncovers Ancient Hominin DNA by SEQadmin2
        Started by SEQadmin2, Today, 02:55 AM
        0 responses
        5 views
        0 reactions
        		 Last Post SEQadmin2
        by SEQadmin2
        Today, 02:55 AM  
        Study Captures the First Moments of DNA Replication by SEQadmin2
        Started by SEQadmin2, 07-24-2026, 12:17 PM
        0 responses
        11 views
        0 reactions
        		 Last Post SEQadmin2
        by SEQadmin2
        07-24-2026, 12:17 PM  
        Chemotherapy Leaves Detectable DNA Signatures in Childhood Tumors by SEQadmin2
        Started by SEQadmin2, 07-23-2026, 11:41 AM
        0 responses
        12 views
        0 reactions
        		 Last Post SEQadmin2
        by SEQadmin2
        07-23-2026, 11:41 AM  
        Single-Cell Atlases Skew Toward European Ancestry, Analysis Finds by SEQadmin2
        Started by SEQadmin2, 07-20-2026, 11:10 AM
        0 responses
        24 views
        0 reactions
        		 Last Post SEQadmin2
        by SEQadmin2
        07-20-2026, 11:10 AM  
        View All
        Working...