Unconfigured Ad

Collapse
X
Collapse
 
  • Page of 1
  • Time
  • Show
Clear All
new posts
Previous template Next
  • Antony03
    Member
    • Apr 2012
    • 53
    #1

    tblastn bug?

    Hello,

    I have a problem with tblastn. I tried to research this protein sequence:

    >BN1129_RS00085
    MNKVLVAGILGLMLTACGQKEEAAAPAATPAADVAATVEQAASEATSTVEKVASEATATVEKAVSKAEAAVSDAKAN

    In the draft sequence with the accession number: CDBI00000000.1

    The problem is that the result is truncated, which is a non-sense since the protein sequence come from this accession number! I tried locally with tfasty36 and there is no problem.

    Is someone has an idea?

    Thank you!
    Tags: None
    • maubp
      Peter (Biopython etc)
      • Jul 2009
      • 1544
      #2
      By default BLAST uses low complexity filters to remove/mask some of the sequence. Try turning off these filters?

        Comment

        Previous template Next

        Latest Articles

        Collapse
        • SEQadmin2
          Multiomic Liquid Biopsy: What DNA/RNA Panels Reveal That DNA Alone Can’t
          by SEQadmin2



          Tumors contain complex mixtures of cell populations that evolve in response to treatment and host-specific factors. Tissue biopsies provide only static snapshots of a tumor’s state. But what if we could follow that evolution over time using a minimally invasive technique?

          Liquid biopsies can detect tumor-derived material circulating in the bloodstream, providing a way to study treatment response, detect emerging resistance, and discover new biomarkers. Circulating          ...
          10-14-2026, 09:55 AM
        • SEQadmin2
          New Genomics Technologies Take Aim at Long-Standing Limits
          by SEQadmin2


          Researchers using sequencing and genomics tools often have to make trade-offs. They can choose between speed or scale, short reads or long-range information, or targeted panels or a view of the whole transcriptome. New technologies that have been released this year are built to address those tough choices.

          We asked six companies the same four questions to learn about their latest products. The new technologies bring a lot to the table, including rethinking sequencing          ...
          09-28-2026, 10:25 AM
        View All

        ad_right_rmr

        Collapse

        News

        Collapse
        Topics Statistics Last Post
        Exeter-Led Study Maps What an Average Human Genome Looks Like by SEQadmin2
        Started by SEQadmin2, Yesterday, 11:13 AM
        0 responses
        16 views
        0 reactions
        		 Last Post SEQadmin2
        by SEQadmin2
        Yesterday, 11:13 AM  
        Long-Read Sequencing Uncovers Cancer Mutations Conventional Testing Missed by SEQadmin2
        Started by SEQadmin2, Yesterday, 10:48 AM
        0 responses
        17 views
        0 reactions
        		 Last Post SEQadmin2
        by SEQadmin2
        Yesterday, 10:48 AM  
        Mayo Clinic-Led Study Detects DNA Mutations Across Noncancerous Tissues by SEQadmin2
        Started by SEQadmin2, 10-15-2026, 10:52 AM
        0 responses
        35 views
        0 reactions
        		 Last Post SEQadmin2
        by SEQadmin2
        10-15-2026, 10:52 AM  
        Study Finds Chromatin Motion Holds Steady Until Cells Face Stress by SEQadmin2
        Started by SEQadmin2, 10-14-2026, 05:39 AM
        0 responses
        42 views
        0 reactions
        		 Last Post SEQadmin2
        by SEQadmin2
        10-14-2026, 05:39 AM  
        View All
        Working...