Seqanswers Leaderboard Ad

Collapse

Announcement

Collapse
No announcement yet.
X
 
  • Filter
  • Time
  • Show
Clear All
new posts

  • bootstrap analysis

    can anyone tell me how to do bootstrap analysis for homologous protein sequence? and how to use NJ plot to visualize branch lenght and bootstrap values?
    This below are the protein sequences result that i have to do bootstrap analysis.

    >Mb_Gg
    MGLSDQEWQQVLTIWGKVEADIAGHGHEVLMRLFHDHPETLDRFDKFKGLKTPDQMKGSEDLKKHGATVL
    TQLGKILKQKGNHESELKPLAQTHATKHKIPVKYLEFISEVIIKVIAEKHAADFGADSQAAMKKALELFR
    NDMASKYKEFGFQG


    >Mb_Tg
    MGLSDQEWQQVLTVWGKVESDLAGHGHQILMRLFQDHPETLDRFEKFKGLKTPDAMKGSEDLKKHGVTVL
    TQLGKILKAKGNHEAELKPLAQTHATKHKIPVKYLEFISEVIIKVLAEKHAADFGADAQAAMKKALELFR
    NDMATKYKEFGFQG


    >Mb_Af
    MGLNDQEWQQVLTMWGKVESDLAGHGHAVLMRLFQDHPETMDRFDKFRGLKTPDQMRGSEDMKKHGVTVL
    TQLGKILKQKGHHESELKPLAQTHATKHRVPVKYLEFICEAIMKVIAEKHSADFGANCQAAMKKALELFR
    HDMASRYKEFGFQG


    >Mb_Cf
    MGLSDGEWQLVLNIWGKVETDLAGHGQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGSEDLKKHGNTVL
    TALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQSKHSGDFHADTEAAMKKALELFR
    NDIAAKYKELGFQG


    >Mb_Hs
    MELGCQVCKYCAMGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKA
    SEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADA
    QGAMNKALELFRKDMASNYKELGFQG

  • #2
    You may use MEGA for this kind of analysis.

    Comment


    • #3
      Another possibility is PHYLIP:

      Comment

      Latest Articles

      Collapse

      • seqadmin
        Best Practices for Single-Cell Sequencing Analysis
        by seqadmin



        While isolating and preparing single cells for sequencing was historically the bottleneck, recent technological advancements have shifted the challenge to data analysis. This highlights the rapidly evolving nature of single-cell sequencing. The inherent complexity of single-cell analysis has intensified with the surge in data volume and the incorporation of diverse and more complex datasets. This article explores the challenges in analysis, examines common pitfalls, offers...
        06-06-2024, 07:15 AM
      • seqadmin
        Latest Developments in Precision Medicine
        by seqadmin



        Technological advances have led to drastic improvements in the field of precision medicine, enabling more personalized approaches to treatment. This article explores four leading groups that are overcoming many of the challenges of genomic profiling and precision medicine through their innovative platforms and technologies.

        Somatic Genomics
        “We have such a tremendous amount of genetic diversity that exists within each of us, and not just between us as individuals,”...
        05-24-2024, 01:16 PM

      ad_right_rmr

      Collapse

      News

      Collapse

      Topics Statistics Last Post
      Started by seqadmin, Today, 07:24 AM
      0 responses
      9 views
      0 likes
      Last Post seqadmin  
      Started by seqadmin, Yesterday, 08:58 AM
      0 responses
      11 views
      0 likes
      Last Post seqadmin  
      Started by seqadmin, 06-12-2024, 02:20 PM
      0 responses
      16 views
      0 likes
      Last Post seqadmin  
      Started by seqadmin, 06-07-2024, 06:58 AM
      0 responses
      184 views
      0 likes
      Last Post seqadmin  
      Working...
      X