Understanding sequence alignment

[bio_informatics]

Hi Members,
Please pardon me if my query seems silly. I've query for sequence alignment.
Suppose, I've 4 sequences: [ I randomly added any amino acid]

>1
WTQRPLPLKGGGGGGGGWWWDSSSHHHHHH
>2
WWWWWAAAAAWTQRPLPLKGGGIG
>3
WTQRAAWTQRPLPLKGGPLPLKGGGGGGGGWWAAAA
>4
WTQRPLPLKGGGGGWWWWWPLPLKGFFQQQ

Ran clustalw2, with default settings:

clustalw2 -infile=test_seq.fasta -type=PROTEIN -output=FASTA -outfile=sampl_out.txt

Got output as:

>1
----------WTQRPLPLKGG-----GGGGGGWWWDSSSHHHHHH-
>4
----------WTQRPLPLKGG-----GGG-WWWWWPLPLKGFFQQQ
>2
WWWWWAAAAAWTQRPLPLKGG-----GIG-----------------
>3
----WTQRAAWTQRPLPLKGGPLPLKGGGGGGGGWWAAAA------

It says, 1, 4, 2, and 3 at last. [ The order of alignment output]

My query is:

- Why 1 on top/first?
- Would the alignment have been different if, it would have said, 3,2,4 and 1 at last?
- On what criteria is the top decided?

Can I decide or change what to have the first?
From what I know, it is global alignment and should not have any impact on alignment irrespective of the placement of protein name.

Kindly throw light on this.

[westerman]

From the manual:

By default, the order corresponds to the order in which the
sequences were aligned (from the guide tree-dendrogram), thus automatically
grouping closely related sequences.

1 is on top probably because it was your first sequence and it is closely related to the others.

[bio_informatics]

That helps.
Thank you.