Seqanswers Leaderboard Ad

Collapse

Announcement

Collapse
No announcement yet.
X
 
  • Filter
  • Time
  • Show
Clear All
new posts

  • Any script to format headers in fasta files?

    I have a 47GB file to parse. The sequences are in following format:
    >TSCS_00041 gene0EA_12345_rframe2_ORF
    MLAATHYYKFAIRRLFPLLKDTICASYSISIKHHENFMALSNMPKIWEDVEVDGNNMQWTRFQTTPVMPVYFIAAGVFNLSFITNWNTKLLYRKDILPYMTFAYNVAKNIAWFLSHIRKTKITNHI
    >TSCS_00044 gene0EA_12341_rframe2_ORF
    MTICASYSISIKHHENFMAIKHHENFMALSNMPKIWEDV
    I simply want to format this file like:
    >TSCS_00041
    MLAATHYYKFAIRRLFPLLKDTICASYSISIKHHENFMALSNMPKIWEDVEVDGNNMQWTRFQTTPVMPVYFIAAGVFNLSFITNWNTKLLYRKDILPYMTFAYNVAKNIAWFLSHIRKTKITNHI
    >TSCS_00044
    MTICASYSISIKHHENFMAIKHHENFMALSNMPKIWEDV
    Could anyone share the script.

  • #2
    cut -f1 -d" " inputold.fa > outputnew.fa

    Comment


    • #3
      Thanks Richard!

      Comment

      Latest Articles

      Collapse

      • seqadmin
        Essential Discoveries and Tools in Epitranscriptomics
        by seqadmin




        The field of epigenetics has traditionally concentrated more on DNA and how changes like methylation and phosphorylation of histones impact gene expression and regulation. However, our increased understanding of RNA modifications and their importance in cellular processes has led to a rise in epitranscriptomics research. “Epitranscriptomics brings together the concepts of epigenetics and gene expression,” explained Adrien Leger, PhD, Principal Research Scientist...
        Yesterday, 07:01 AM
      • seqadmin
        Current Approaches to Protein Sequencing
        by seqadmin


        Proteins are often described as the workhorses of the cell, and identifying their sequences is key to understanding their role in biological processes and disease. Currently, the most common technique used to determine protein sequences is mass spectrometry. While still a valuable tool, mass spectrometry faces several limitations and requires a highly experienced scientist familiar with the equipment to operate it. Additionally, other proteomic methods, like affinity assays, are constrained...
        04-04-2024, 04:25 PM

      ad_right_rmr

      Collapse

      News

      Collapse

      Topics Statistics Last Post
      Started by seqadmin, 04-11-2024, 12:08 PM
      0 responses
      57 views
      0 likes
      Last Post seqadmin  
      Started by seqadmin, 04-10-2024, 10:19 PM
      0 responses
      53 views
      0 likes
      Last Post seqadmin  
      Started by seqadmin, 04-10-2024, 09:21 AM
      0 responses
      45 views
      0 likes
      Last Post seqadmin  
      Started by seqadmin, 04-04-2024, 09:00 AM
      0 responses
      55 views
      0 likes
      Last Post seqadmin  
      Working...
      X